SCOPe 2.04: Domain d4kgxa2: 4kgx A:151-310

Lineage for d4kgxa2 (4kgx A:151-310)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d4kgxa2: 4kgx A:151-310 [229280]
   Other proteins in same PDB: d4kgxb1, d4kgxb2, d4kgxd1, d4kgxd2
   automated match to d3csua2
   complexed with ctp, pal, zn

Details for d4kgxa2

PDB Entry: 4kgx, 2.2 Å

PDB Description: the r state structure of e. coli atcase with ctp bound

PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d4kgxa2:

Sequence; same for both SEQRES and ATOM records:

>d4kgxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d4kgxa2:

• d4kgxa2 first appeared in SCOPe 2.03
  
• d4kgxa2 appears in SCOPe 2.05
  
• d4kgxa2 appears in the current release, SCOPe 2.08