Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species) |
Species Escherichia coli [TaxId:562] [53674] (62 PDB entries) Uniprot P00479 |
Domain d4kgxa1: 4kgx A:1-150 [229279] Other proteins in same PDB: d4kgxb1, d4kgxb2, d4kgxd1, d4kgxd2 automated match to d3csua1 complexed with ctp, pal, zn |
PDB Entry: 4kgx (more details), 2.2 Å
SCOPe Domain Sequences for d4kgxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kgxa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d4kgxa1: