SCOPe 2.03: Domain d4kgxa1: 4kgx A:1-150

Lineage for d4kgxa1 (4kgx A:1-150)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)

7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
   Uniprot P00479

8. Domain d4kgxa1: 4kgx A:1-150 [229279]
   Other proteins in same PDB: d4kgxb1, d4kgxb2, d4kgxd1, d4kgxd2
   automated match to d3csua1
   complexed with ctp, pal, zn

Details for d4kgxa1

PDB Entry: 4kgx, 2.2 Å

PDB Description: the r state structure of e. coli atcase with ctp bound

PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d4kgxa1:

Sequence; same for both SEQRES and ATOM records:

>d4kgxa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d4kgxa1:

• d4kgxa1 is new in SCOPe 2.03-stable
  
• d4kgxa1 appears in SCOPe 2.04
  
• d4kgxa1 appears in the current release, SCOPe 2.08