Lineage for d4kgvb2 (4kgv B:101-153)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641542Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2641543Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2641544Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2641545Species Escherichia coli [TaxId:562] [57828] (63 PDB entries)
    Uniprot P00478
  8. 2641554Domain d4kgvb2: 4kgv B:101-153 [229276]
    Other proteins in same PDB: d4kgva1, d4kgva2, d4kgvb1, d4kgvc1, d4kgvc2, d4kgvd1
    automated match to d2fzcb2
    complexed with atp, pal, zn

Details for d4kgvb2

PDB Entry: 4kgv (more details), 2.1 Å

PDB Description: The R state structure of E. coli ATCase with ATP bound
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4kgvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kgvb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d4kgvb2:

Click to download the PDB-style file with coordinates for d4kgvb2.
(The format of our PDB-style files is described here.)

Timeline for d4kgvb2: