SCOPe 2.07: Domain d4kgzb2: 4kgz B:101-153

Lineage for d4kgzb2 (4kgz B:101-153)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (63 PDB entries)
   Uniprot P00478

8. Domain d4kgzb2: 4kgz B:101-153 [229270]
   Other proteins in same PDB: d4kgza1, d4kgza2, d4kgzb1, d4kgzc1, d4kgzc2, d4kgzd1
   automated match to d2fzcb2
   complexed with mg, pal, utp, zn

Details for d4kgzb2

PDB Entry: 4kgz, 2.4 Å

PDB Description: the r state structure of e. coli atcase with utp and magnesium bound

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4kgzb2:

Sequence; same for both SEQRES and ATOM records:

>d4kgzb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d4kgzb2:

• d4kgzb2 first appeared in SCOPe 2.03
  
• d4kgzb2 appears in SCOPe 2.06
  
• d4kgzb2 appears in the current release, SCOPe 2.08