![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) ![]() automatically mapped to Pfam PF01948 |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (62 PDB entries) Uniprot P00478 |
![]() | Domain d4kgzb1: 4kgz B:10-100 [229269] Other proteins in same PDB: d4kgza1, d4kgza2, d4kgzb2, d4kgzc1, d4kgzc2, d4kgzd2 automated match to d2fzcb1 complexed with mg, pal, utp, zn |
PDB Entry: 4kgz (more details), 2.4 Å
SCOPe Domain Sequences for d4kgzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kgzb1 d.58.2.1 (B:10-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} eaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsed qvdqlalyapqatvnridnyevvgksrpslp
Timeline for d4kgzb1: