![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [53674] (63 PDB entries) Uniprot P00479 |
![]() | Domain d4kgza1: 4kgz A:1-150 [229263] Other proteins in same PDB: d4kgzb1, d4kgzb2, d4kgzd1, d4kgzd2 automated match to d3csua1 complexed with mg, pal, utp, zn |
PDB Entry: 4kgz (more details), 2.4 Å
SCOPe Domain Sequences for d4kgza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kgza1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d4kgza1: