Lineage for d4jacb_ (4jac B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688404Species Amphitrite ornata [TaxId:129555] [189339] (47 PDB entries)
  8. 2688458Domain d4jacb_: 4jac B: [229254]
    automated match to d3lb2a_
    complexed with azi, hem, so4

Details for d4jacb_

PDB Entry: 4jac (more details), 1.93 Å

PDB Description: Dehaloperoxidase-Hemoglobin T56S
PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d4jacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jacb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhsekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d4jacb_:

Click to download the PDB-style file with coordinates for d4jacb_.
(The format of our PDB-style files is described here.)

Timeline for d4jacb_: