Lineage for d4iisb_ (4iis B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831308Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [189057] (4 PDB entries)
  8. 2831314Domain d4iisb_: 4iis B: [229245]
    automated match to d3em5a_
    complexed with cac, flc, na

Details for d4iisb_

PDB Entry: 4iis (more details), 2.67 Å

PDB Description: crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis (space group p41)
PDB Compounds: (B:) Beta-1,3-glucanase form 'RRII Gln 2'

SCOPe Domain Sequences for d4iisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iisb_ c.1.8.3 (B:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
evgvcygmqgnnlppvsevialykksnitrmriydpnqavlealrgsnielilgvpnsdl
qsltnpsnakswvqknvrgfwssvrfryiavgneispvnrgtawlaqfvlpamrnihdai
rsaglqdqikvstaidltlvgnsyppsagafrddvrsylnpiirflssirspllaniypy
ftyagnprdislpyalftspsvvvwdgqrgyknlfdatldalysalerasggslevvvse
sgwpsagafaatfdngrtylsnliqhvkrgtpkrpkraietylfamfdenkkqpevekhf
glffpnkwqkynlnfs

SCOPe Domain Coordinates for d4iisb_:

Click to download the PDB-style file with coordinates for d4iisb_.
(The format of our PDB-style files is described here.)

Timeline for d4iisb_: