Lineage for d4iisd_ (4iis D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1340396Protein automated matches [190057] (15 species)
    not a true protein
  7. 1340428Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [189057] (4 PDB entries)
  8. 1340444Domain d4iisd_: 4iis D: [229243]
    automated match to d3em5a_
    complexed with cac, flc, na

Details for d4iisd_

PDB Entry: 4iis (more details), 2.67 Å

PDB Description: crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis (space group p41)
PDB Compounds: (D:) Beta-1,3-glucanase form 'RRII Gln 2'

SCOPe Domain Sequences for d4iisd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iisd_ c.1.8.3 (D:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
evgvcygmqgnnlppvsevialykksnitrmriydpnqavlealrgsnielilgvpnsdl
qsltnpsnakswvqknvrgfwssvrfryiavgneispvnrgtawlaqfvlpamrnihdai
rsaglqdqikvstaidltlvgnsyppsagafrddvrsylnpiirflssirspllaniypy
ftyagnprdislpyalftspsvvvwdgqrgyknlfdatldalysalerasggslevvvse
sgwpsagafaatfdngrtylsnliqhvkrgtpkrpkraietylfamfdenkkqpevekhf
glffpnkwqkynlnfs

SCOPe Domain Coordinates for d4iisd_:

Click to download the PDB-style file with coordinates for d4iisd_.
(The format of our PDB-style files is described here.)

Timeline for d4iisd_: