SCOPe 2.07: Domain d4i1nb1: 4i1n B:1-126

Lineage for d4i1nb1 (4i1n B:1-126)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d4i1nb1: 4i1n B:1-126 [229241]
   Other proteins in same PDB: d4i1na_, d4i1nb2
   automated match to d3qxta_
   complexed with fol

Details for d4i1nb1

PDB Entry: 4i1n, 1.89 Å

PDB Description: R104A-ca1697 nanobody binding to the binary DHFR.folate complex

PDB Compounds: (B:) Protein ca1697 (nanobody)

SCOPe Domain Sequences for d4i1nb1:

Sequence; same for both SEQRES and ATOM records:

>d4i1nb1 b.1.1.1 (B:1-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqagaslrlscaaserltvdyaigwfrqapgkerefvaaiswgggltvy
gesvegrftisrdiakntmnlqmnvlrpedtanyycaasrisyavwntipynkltlwgrg
tqvtvs

Timeline for d4i1nb1:

• d4i1nb1 first appeared in SCOPe 2.03, called d4i1nb_
  
• d4i1nb1 appears in SCOPe 2.06
  
• d4i1nb1 appears in the current release, SCOPe 2.08