Lineage for d4i1nb1 (4i1n B:1-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743763Domain d4i1nb1: 4i1n B:1-126 [229241]
    Other proteins in same PDB: d4i1na_, d4i1nb2
    automated match to d3qxta_
    complexed with fol

Details for d4i1nb1

PDB Entry: 4i1n (more details), 1.89 Å

PDB Description: R104A-ca1697 nanobody binding to the binary DHFR.folate complex
PDB Compounds: (B:) Protein ca1697 (nanobody)

SCOPe Domain Sequences for d4i1nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i1nb1 b.1.1.1 (B:1-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqagaslrlscaaserltvdyaigwfrqapgkerefvaaiswgggltvy
gesvegrftisrdiakntmnlqmnvlrpedtanyycaasrisyavwntipynkltlwgrg
tqvtvs

SCOPe Domain Coordinates for d4i1nb1:

Click to download the PDB-style file with coordinates for d4i1nb1.
(The format of our PDB-style files is described here.)

Timeline for d4i1nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i1nb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4i1na_