| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Chlorella sorokiniana [TaxId:3076] [229236] (2 PDB entries) |
| Domain d4i2ua1: 4i2u A:2-105 [229237] Other proteins in same PDB: d4i2ua2 automated match to d1jhba_ complexed with gsh |
PDB Entry: 4i2u (more details), 1.3 Å
SCOPe Domain Sequences for d4i2ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i2ua1 c.47.1.0 (A:2-105) automated matches {Chlorella sorokiniana [TaxId: 3076]}
saakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqdy
lleltggrsvprvfidgqfigggddtdalarngklevmlrnagv
Timeline for d4i2ua1: