SCOPe 2.08: Domain d4i2ua1: 4i2u A:2-105

Lineage for d4i2ua1 (4i2u A:2-105)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Chlorella sorokiniana [TaxId:3076] [229236] (2 PDB entries)

8. Domain d4i2ua1: 4i2u A:2-105 [229237]
   Other proteins in same PDB: d4i2ua2
   automated match to d1jhba_
   complexed with gsh

Details for d4i2ua1

PDB Entry: 4i2u, 1.3 Å

PDB Description: Crystal structure of the reduced glutaredoxin from Chlorella sorokiniana T-89 in complex with glutathione

PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d4i2ua1:

Sequence; same for both SEQRES and ATOM records:

>d4i2ua1 c.47.1.0 (A:2-105) automated matches {Chlorella sorokiniana [TaxId: 3076]}
saakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqdy
lleltggrsvprvfidgqfigggddtdalarngklevmlrnagv

Timeline for d4i2ua1:

• d4i2ua1 first appeared in SCOPe 2.03, called d4i2ua_
  
• d4i2ua1 appears in SCOPe 2.07