SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4i2ua1 (4i2u A:2-105)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (157 species)
    not a true protein
  7. 2119308Species Chlorella sorokiniana [TaxId:3076] [229236] (2 PDB entries)
  8. 2119309Domain d4i2ua1: 4i2u A:2-105 [229237]
    Other proteins in same PDB: d4i2ua2
    automated match to d1jhba_
    complexed with gsh

Details for d4i2ua1

PDB Entry: 4i2u (more details), 1.3 Å

PDB Description: Crystal structure of the reduced glutaredoxin from Chlorella sorokiniana T-89 in complex with glutathione
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d4i2ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2ua1 c.47.1.0 (A:2-105) automated matches {Chlorella sorokiniana [TaxId: 3076]}
saakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqdy
lleltggrsvprvfidgqfigggddtdalarngklevmlrnagv

SCOPe Domain Coordinates for d4i2ua1:

Click to download the PDB-style file with coordinates for d4i2ua1.
(The format of our PDB-style files is described here.)

Timeline for d4i2ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i2ua2