SCOP 1.59: Domain d2azua_: 2azu A:

Lineage for d2azua_ (2azu A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (31 PDB entries)

8. Domain d2azua_: 2azu A: [22923]

Details for d2azua_

PDB Entry: 2azu, 1.9 Å

PDB Description: x-ray crystal structure of the two site-specific mutants his35*gln and his35*leu of azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d2azua_:

Sequence; same for both SEQRES and ATOM records:

>d2azua_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa}
aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d2azua_:

• d2azua_ first appeared (with stable ids) in SCOP 1.55
  
• d2azua_ appears in SCOP 1.57
  
• d2azua_ appears in SCOP 1.61
  
• d2azua_ appears in the current release, SCOPe 2.08