Lineage for d4bkti_ (4bkt I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768885Domain d4bkti_: 4bkt I: [229205]
    Other proteins in same PDB: d4bkta_, d4bktb_, d4bktd_, d4bkte_, d4bktg_, d4bkth_, d4bktj_, d4bktk1, d4bktk2
    automated match to d1lqbc_
    complexed with arg, glu, qd0

Details for d4bkti_

PDB Entry: 4bkt (more details), 2.35 Å

PDB Description: von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl- pyrrolidine-2-carboxamide
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4bkti_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bkti_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d4bkti_:

Click to download the PDB-style file with coordinates for d4bkti_.
(The format of our PDB-style files is described here.)

Timeline for d4bkti_: