Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d4bktc_: 4bkt C: [229202] Other proteins in same PDB: d4bkta_, d4bktb_, d4bktd_, d4bkte_, d4bktg_, d4bkth_, d4bktj_, d4bktk1, d4bktk2 automated match to d1lqbc_ complexed with arg, glu, qd0 |
PDB Entry: 4bkt (more details), 2.35 Å
SCOPe Domain Sequences for d4bktc_:
Sequence, based on SEQRES records: (download)
>d4bktc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerl
>d4bktc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvqpifanitlpvytlkerclqvvrslvkpenyrrldivrs lyedledhpnvqkdlerl
Timeline for d4bktc_: