Lineage for d4bktb_ (4bkt B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552339Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2552434Protein Elongin C [54699] (3 species)
  7. 2552437Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)
  8. 2552543Domain d4bktb_: 4bkt B: [229201]
    Other proteins in same PDB: d4bkta_, d4bktc_, d4bktd_, d4bktf_, d4bktg_, d4bkti_, d4bktj_, d4bktk2, d4bktl_
    automated match to d2c9wc_
    complexed with arg, glu, qd0

Details for d4bktb_

PDB Entry: 4bkt (more details), 2.35 Å

PDB Description: von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl- pyrrolidine-2-carboxamide
PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4bktb_:

Sequence, based on SEQRES records: (download)

>d4bktb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4bktb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4bktb_:

Click to download the PDB-style file with coordinates for d4bktb_.
(The format of our PDB-style files is described here.)

Timeline for d4bktb_: