Lineage for d4bktd_ (4bkt D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538361Protein Elongin B [54246] (2 species)
  7. 2538362Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. 2538464Domain d4bktd_: 4bkt D: [229197]
    Other proteins in same PDB: d4bktb_, d4bktc_, d4bkte_, d4bktf_, d4bkth_, d4bkti_, d4bktk1, d4bktk2, d4bktl_
    automated match to d4awjg_
    complexed with arg, glu, qd0

Details for d4bktd_

PDB Entry: 4bkt (more details), 2.35 Å

PDB Description: von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl- pyrrolidine-2-carboxamide
PDB Compounds: (D:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4bktd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bktd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdv

SCOPe Domain Coordinates for d4bktd_:

Click to download the PDB-style file with coordinates for d4bktd_.
(The format of our PDB-style files is described here.)

Timeline for d4bktd_: