| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries) |
| Domain d4bktd_: 4bkt D: [229197] Other proteins in same PDB: d4bktb_, d4bktc_, d4bkte_, d4bktf_, d4bkth_, d4bkti_, d4bktk1, d4bktk2, d4bktl_ automated match to d4awjg_ complexed with arg, glu, qd0 |
PDB Entry: 4bkt (more details), 2.35 Å
SCOPe Domain Sequences for d4bktd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bktd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdv
Timeline for d4bktd_: