Lineage for d4bksk_ (4bks K:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411215Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1411216Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1411217Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1411266Protein Elongin C [54699] (3 species)
  7. 1411269Species Human (Homo sapiens) [TaxId:9606] [54700] (18 PDB entries)
  8. 1411283Domain d4bksk_: 4bks K: [229195]
    Other proteins in same PDB: d4bksa_, d4bksc_, d4bksd_, d4bksf_, d4bksg_, d4bksi_, d4bksj_, d4bksl_
    automated match to d4awjk_
    complexed with act, x6c

Details for d4bksk_

PDB Entry: 4bks (more details), 2.2 Å

PDB Description: von Hippel Lindau protein:ElonginB:ElonginC complex, in complex with (2S,4R)-1-ethanoyl-N-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
PDB Compounds: (K:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4bksk_:

Sequence, based on SEQRES records: (download)

>d4bksk_ d.42.1.1 (K:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
yftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4bksk_ d.42.1.1 (K:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
mmyvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4bksk_:

Click to download the PDB-style file with coordinates for d4bksk_.
(The format of our PDB-style files is described here.)

Timeline for d4bksk_: