Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (7 PDB entries) |
Domain d4bksl_: 4bks L: [229191] Other proteins in same PDB: d4bksa_, d4bksb_, d4bksd_, d4bkse_, d4bksg_, d4bksh_, d4bksj_, d4bksk_ automated match to d1lqbc_ complexed with act, x6c |
PDB Entry: 4bks (more details), 2.2 Å
SCOPe Domain Sequences for d4bksl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bksl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqer
Timeline for d4bksl_: