Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Azurin [49530] (6 species) |
Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (4 PDB entries) |
Domain d1dz0a_: 1dz0 A: [22918] Reduced azurin II complexed with cu1 |
PDB Entry: 1dz0 (more details), 1.75 Å
SCOPe Domain Sequences for d1dz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dz0a_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam mkgtlklgs
Timeline for d1dz0a_: