SCOPe 2.06: Domain d1dz0a_: 1dz0 A:

Lineage for d1dz0a_ (1dz0 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (4 PDB entries)

8. Domain d1dz0a_: 1dz0 A: [22918]
   Reduced azurin II
   complexed with cu1

Details for d1dz0a_

PDB Entry: 1dz0, 1.75 Å

PDB Description: reduced azurin ii from alcaligenes xylosoxidans

PDB Compounds: (A:) azurin II

SCOPe Domain Sequences for d1dz0a_:

Sequence; same for both SEQRES and ATOM records:

>d1dz0a_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}
aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
mkgtlklgs

Timeline for d1dz0a_:

• d1dz0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dz0a_ appears in SCOPe 2.05
  
• d1dz0a_ appears in SCOPe 2.07
  
• d1dz0a_ appears in the current release, SCOPe 2.08