Lineage for d1dz0a_ (1dz0 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660500Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 660556Protein Azurin [49530] (6 species)
  7. 660576Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (4 PDB entries)
  8. 660579Domain d1dz0a_: 1dz0 A: [22918]
    Reduced azurin II
    complexed with cu1

Details for d1dz0a_

PDB Entry: 1dz0 (more details), 1.75 Å

PDB Description: reduced azurin ii from alcaligenes xylosoxidans
PDB Compounds: (A:) azurin II

SCOP Domain Sequences for d1dz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dz0a_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}
aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
mkgtlklgs

SCOP Domain Coordinates for d1dz0a_:

Click to download the PDB-style file with coordinates for d1dz0a_.
(The format of our PDB-style files is described here.)

Timeline for d1dz0a_: