Lineage for d3zbta2 (3zbt A:142-303)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2467996Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2468084Protein automated matches [226995] (7 species)
    not a true protein
  7. 2468099Species Nostoc sp. [TaxId:1168] [229177] (3 PDB entries)
  8. 2468101Domain d3zbta2: 3zbt A:142-303 [229178]
    Other proteins in same PDB: d3zbta1
    automated match to d1ewya2
    complexed with fad, gol, so4; mutant

Details for d3zbta2

PDB Entry: 3zbt (more details), 1.92 Å

PDB Description: ferredoxin-nadp reductase mutant with ser 59 replaced by ala (s59a)
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3zbta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zbta2 c.25.1.1 (A:142-303) automated matches {Nostoc sp. [TaxId: 1168]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOPe Domain Coordinates for d3zbta2:

Click to download the PDB-style file with coordinates for d3zbta2.
(The format of our PDB-style files is described here.)

Timeline for d3zbta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zbta1