Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (5 proteins) |
Protein automated matches [226995] (7 species) not a true protein |
Species Nostoc sp. [TaxId:1168] [229177] (3 PDB entries) |
Domain d3zbta2: 3zbt A:142-303 [229178] Other proteins in same PDB: d3zbta1 automated match to d1ewya2 complexed with fad, gol, so4; mutant |
PDB Entry: 3zbt (more details), 1.92 Å
SCOPe Domain Sequences for d3zbta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zbta2 c.25.1.1 (A:142-303) automated matches {Nostoc sp. [TaxId: 1168]} lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthtyic glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
Timeline for d3zbta2: