Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein automated matches [227029] (5 species) not a true protein |
Species Nostoc sp. [TaxId:1168] [229175] (3 PDB entries) |
Domain d3zbta1: 3zbt A:9-141 [229176] Other proteins in same PDB: d3zbta2 automated match to d1quea1 complexed with fad, gol, so4; mutant |
PDB Entry: 3zbt (more details), 1.92 Å
SCOPe Domain Sequences for d3zbta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zbta1 b.43.4.2 (A:9-141) automated matches {Nostoc sp. [TaxId: 1168]} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqaigiippgvd kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs evkitgpvgkeml
Timeline for d3zbta1: