![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (7 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries) |
![]() | Domain d4n5zx_: 4n5z X: [229168] Other proteins in same PDB: d4n5za_, d4n5zc_, d4n5ze_, d4n5zg_, d4n5zi_, d4n5zk_, d4n5zm_, d4n5zo_, d4n5zq_, d4n5zs_, d4n5zu_, d4n5zw_, d4n5zy_ automated match to d2fk0b1 complexed with nag; mutant |
PDB Entry: 4n5z (more details), 2.95 Å
SCOPe Domain Sequences for d4n5zx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n5zx_ h.3.1.1 (X:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
Timeline for d4n5zx_: