Lineage for d4n5zj_ (4n5z J:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467406Domain d4n5zj_: 4n5z J: [229161]
    Other proteins in same PDB: d4n5ze_, d4n5zg_
    automated match to d2fk0b1
    complexed with nag; mutant

Details for d4n5zj_

PDB Entry: 4n5z (more details), 2.95 Å

PDB Description: Crystal structure of aerosol transmissible influenza H5 hemagglutinin mutant (N158D, N224K, Q226L and T318I) from the influenza virus A/Viet Nam/1203/2004 (H5N1)
PDB Compounds: (J:) Hemagglutinin

SCOPe Domain Sequences for d4n5zj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5zj_ h.3.1.1 (J:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr

SCOPe Domain Coordinates for d4n5zj_:

Click to download the PDB-style file with coordinates for d4n5zj_.
(The format of our PDB-style files is described here.)

Timeline for d4n5zj_:

  • d4n5zj_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-07
  • d4n5zj_ appears in SCOPe 2.04
  • d4n5zj_ appears in the current release, SCOPe 2.07, called d4n5zj1