Lineage for d1a4cd_ (1a4c D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774206Protein Azurin [49530] (6 species)
  7. 1774207Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. 1774225Domain d1a4cd_: 1a4c D: [22916]
    complexed with cu, no3, so4; mutant

Details for d1a4cd_

PDB Entry: 1a4c (more details), 2.45 Å

PDB Description: azurin mutant with met 121 replaced by his, ph 3.5 crystal form, data collected at-180 degrees celsius
PDB Compounds: (D:) Azurin

SCOPe Domain Sequences for d1a4cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4cd_ b.6.1.1 (D:) Azurin {Alcaligenes denitrificans [TaxId: 32002]}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn

SCOPe Domain Coordinates for d1a4cd_:

Click to download the PDB-style file with coordinates for d1a4cd_.
(The format of our PDB-style files is described here.)

Timeline for d1a4cd_: