SCOPe 2.07: Domain d4n07c1: 4n07 C:3-262

Lineage for d4n07c1 (4n07 C:3-262)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d4n07c1: 4n07 C:3-262 [229143]
   Other proteins in same PDB: d4n07a2, d4n07b2, d4n07c2
   automated match to d3tkda_
   complexed with 2j9, act, cac, glu, gol, zn

Details for d4n07c1

PDB Entry: 4n07, 1.87 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j-l483y- n754s) in complex with glutamate and bpam-344 at 1.87 a resolution

PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d4n07c1:

Sequence; same for both SEQRES and ATOM records:

>d4n07c1 c.94.1.1 (C:3-262) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecg

Timeline for d4n07c1:

• d4n07c1 first appeared in SCOPe 2.03, called d4n07c_
  
• d4n07c1 appears in SCOPe 2.06
  
• d4n07c1 appears in the current release, SCOPe 2.08