| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein Glutamate receptor ligand binding core [53881] (5 species) |
| Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries) |
| Domain d4n07b1: 4n07 B:3-261 [229141] Other proteins in same PDB: d4n07a2, d4n07b2, d4n07c2 automated match to d3tdjb_ complexed with 2j9, act, cac, glu, gol, zn |
PDB Entry: 4n07 (more details), 1.87 Å
SCOPe Domain Sequences for d4n07b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n07b1 c.94.1.1 (B:3-261) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgec
Timeline for d4n07b1:
View in 3DDomains from other chains: (mouse over for more information) d4n07a1, d4n07a2, d4n07c1, d4n07c2 |