Lineage for d1a4cb_ (1a4c B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10917Protein Azurin [49530] (6 species)
  7. 10918Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. 10934Domain d1a4cb_: 1a4c B: [22914]

Details for d1a4cb_

PDB Entry: 1a4c (more details), 2.45 Å

PDB Description: azurin mutant with met 121 replaced by his, ph 3.5 crystal form, data collected at-180 degrees celsius

SCOP Domain Sequences for d1a4cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4cb_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn

SCOP Domain Coordinates for d1a4cb_:

Click to download the PDB-style file with coordinates for d1a4cb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4cb_: