Lineage for d4mwya_ (4mwy A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2064995Protein Influenza neuraminidase [50943] (4 species)
  7. 2065006Species Influenza A virus, different strains [TaxId:11320] [50944] (78 PDB entries)
    Uniprot P03472 84-470
  8. 2065068Domain d4mwya_: 4mwy A: [229138]
    automated match to d1nmbn_
    complexed with ca, lnv, nag

Details for d4mwya_

PDB Entry: 4mwy (more details), 1.8 Å

PDB Description: shanghai n9-laninamivir
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4mwya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mwya_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rnfnnltkglctinswhiygkdnavrigessdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgksrmsicisgpnnn
asavvwynrrpvaeintwarnilrtqesecvchngvcpvvftdgsatgpadtriyyfkeg
kilkwesltgtakhieecscygertgitctckdnwqgsnrpviqidpvamthtsqyicsp
vltdnprpndpnigkcndpypgnnnngvkgfsyldgantwlgrtistasrsgyemlkvpn
altddrskpiqgqtivlnadwsgysgsfmdywaegdcyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwnwpdgakieyfl

SCOPe Domain Coordinates for d4mwya_:

Click to download the PDB-style file with coordinates for d4mwya_.
(The format of our PDB-style files is described here.)

Timeline for d4mwya_: