Lineage for d4m1uf_ (4m1u F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1314026Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 1314161Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (2 PDB entries)
  8. 1314171Domain d4m1uf_: 4m1u F: [229131]
    Other proteins in same PDB: d4m1ua_
    automated match to d1r4pb_
    complexed with 1ps

Details for d4m1uf_

PDB Entry: 4m1u (more details), 1.56 Å

PDB Description: the crystal structure of stx2 and a disaccharide ligand
PDB Compounds: (F:) Shiga toxin 2 B subunit

SCOPe Domain Sequences for d4m1uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1uf_ b.40.2.1 (F:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II [TaxId: 622]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOPe Domain Coordinates for d4m1uf_:

Click to download the PDB-style file with coordinates for d4m1uf_.
(The format of our PDB-style files is described here.)

Timeline for d4m1uf_: