![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
![]() | Protein Hypothetical protein EF1143 [140767] (1 species) Probable ortholog of aq_1910 |
![]() | Species Enterococcus faecalis [TaxId:1351] [140768] (4 PDB entries) Uniprot Q836G9 1-453 |
![]() | Domain d4lrlc_: 4lrl C: [229115] Other proteins in same PDB: d4lrla2 automated match to d3irhd_ complexed with dgt, mli, ni, trs, ttp has additional subdomain(s) that are not in the common domain |
PDB Entry: 4lrl (more details), 2.35 Å
SCOPe Domain Sequences for d4lrlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lrlc_ a.211.1.1 (C:) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]} tipykeqrlpiekvfrdpvhnyihvqhqvildlinsaevqrlrrikqlgtssftfhgaeh srfshslgvyeitrriceifqrnysverlgengwndderlitlcaallhdvghgpyshtf ehifdtnheaitvqiitspetevyqilnrvsadfpekvasvitkqypnpqvvqmissqid adrmdyllrdayftgteygtfdltrilrvirpykggiafamngmhavedyivsryqmyvq vyfhpvsrgmevildhllhrakelfenpefdydlqasllvpffkgdftlqeylklddgvl styftqwmdvpdsilgdlakrflmrkplksatftnekesaatiaylreliekvgfnpkyy tainssydlpydfyrpnkdrhrtqielmqkdgslvelatvsplvaalagqsqgderfyfp kemldqgnkkhydlfdetyrefssyihngalvlkk
Timeline for d4lrlc_:
![]() Domains from other chains: (mouse over for more information) d4lrla1, d4lrla2, d4lrlb_, d4lrld_ |