Lineage for d4lrlc_ (4lrl C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736617Family a.211.1.1: HD domain [101340] (15 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2736647Protein Hypothetical protein EF1143 [140767] (1 species)
    Probable ortholog of aq_1910
  7. 2736648Species Enterococcus faecalis [TaxId:1351] [140768] (4 PDB entries)
    Uniprot Q836G9 1-453
  8. 2736653Domain d4lrlc_: 4lrl C: [229115]
    Other proteins in same PDB: d4lrla2
    automated match to d3irhd_
    complexed with dgt, mli, ni, trs, ttp
    has additional subdomain(s) that are not in the common domain

Details for d4lrlc_

PDB Entry: 4lrl (more details), 2.35 Å

PDB Description: structure of an enterococcus faecalis hd-domain protein complexed with dgtp and dttp
PDB Compounds: (C:) HD domain protein

SCOPe Domain Sequences for d4lrlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lrlc_ a.211.1.1 (C:) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]}
tipykeqrlpiekvfrdpvhnyihvqhqvildlinsaevqrlrrikqlgtssftfhgaeh
srfshslgvyeitrriceifqrnysverlgengwndderlitlcaallhdvghgpyshtf
ehifdtnheaitvqiitspetevyqilnrvsadfpekvasvitkqypnpqvvqmissqid
adrmdyllrdayftgteygtfdltrilrvirpykggiafamngmhavedyivsryqmyvq
vyfhpvsrgmevildhllhrakelfenpefdydlqasllvpffkgdftlqeylklddgvl
styftqwmdvpdsilgdlakrflmrkplksatftnekesaatiaylreliekvgfnpkyy
tainssydlpydfyrpnkdrhrtqielmqkdgslvelatvsplvaalagqsqgderfyfp
kemldqgnkkhydlfdetyrefssyihngalvlkk

SCOPe Domain Coordinates for d4lrlc_:

Click to download the PDB-style file with coordinates for d4lrlc_.
(The format of our PDB-style files is described here.)

Timeline for d4lrlc_: