Lineage for d4lrlb_ (4lrl B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014861Protein Hypothetical protein EF1143 [140767] (1 species)
    Probable ortholog of aq_1910
  7. 2014862Species Enterococcus faecalis [TaxId:1351] [140768] (4 PDB entries)
    Uniprot Q836G9 1-453
  8. 2014868Domain d4lrlb_: 4lrl B: [229114]
    Other proteins in same PDB: d4lrla2
    automated match to d3irhd_
    complexed with dgt, mli, ni, trs, ttp

Details for d4lrlb_

PDB Entry: 4lrl (more details), 2.35 Å

PDB Description: structure of an enterococcus faecalis hd-domain protein complexed with dgtp and dttp
PDB Compounds: (B:) HD domain protein

SCOPe Domain Sequences for d4lrlb_:

Sequence, based on SEQRES records: (download)

>d4lrlb_ a.211.1.1 (B:) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]}
tipykeqrlpiekvfrdpvhnyihvqhqvildlinsaevqrlrrikqlgtssftfhgaeh
srfshslgvyeitrriceifqrnysverlgengwndderlitlcaallhdvghgpyshtf
ehifdtnheaitvqiitspetevyqilnrvsadfpekvasvitkqypnpqvvqmissqid
adrmdyllrdayftgteygtfdltrilrvirpykggiafamngmhavedyivsryqmyvq
vyfhpvsrgmevildhllhrakelfenpefdydlqasllvpffkgdftlqeylklddgvl
styftqwmdvpdsilgdlakrflmrkplksatftnekesaatiaylreliekvgfnpkyy
tainssydlpydfyrpnkdrhrtqielmqkdgslvelatvsplvaalagqsqgderfyfp
kemldqgnkkhydlfdetyrefssyihngalvlkk

Sequence, based on observed residues (ATOM records): (download)

>d4lrlb_ a.211.1.1 (B:) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]}
tipykeqrlpiekvfrdpvhnyihvqhqvildlinsaevqrlrrikqlgtssftfhgaeh
srfshslgvyeitrriceifqrnysverlgengwndderlitlcaallhdvghgpyshtf
ehifdtnheaitvqiitspetevyqilnrvsadfpekvasvitkqypnpqvvqmissqid
adrmdyllrdayftgteygtfdltrilrvirpykggiafamngmhavedyivsryqmyvq
vyfhpvsrgmevildhllhrakelfenpefdydlqasllvpffkgdftlqeylklddgvl
styftqwmdvpdsilgdlakrflmrkplksatftnekesaatiaylreliekvgfnpkyy
tainssydlpydfyrprhrtqielmqkdgslvelatvsplvaalagqsqgderfyfpkem
lddlfdetyrefssyihngalvlkk

SCOPe Domain Coordinates for d4lrlb_:

Click to download the PDB-style file with coordinates for d4lrlb_.
(The format of our PDB-style files is described here.)

Timeline for d4lrlb_: