![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
![]() | Protein automated matches [190782] (2 species) not a true protein |
![]() | Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (4 PDB entries) |
![]() | Domain d4lp8a2: 4lp8 A:139-295 [229113] Other proteins in same PDB: d4lp8a1, d4lp8a3 automated match to d1xl4a1 complexed with cl, k, peg |
PDB Entry: 4lp8 (more details), 2.46 Å
SCOPe Domain Sequences for d4lp8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lp8a2 b.1.18.16 (A:139-295) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl tltrsrlpifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaq
Timeline for d4lp8a2: