Lineage for d4lp8a2 (4lp8 A:139-295)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765908Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 2765926Protein automated matches [190782] (2 species)
    not a true protein
  7. 2765927Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (5 PDB entries)
  8. 2765929Domain d4lp8a2: 4lp8 A:139-295 [229113]
    Other proteins in same PDB: d4lp8a1, d4lp8a3
    automated match to d1xl4a1
    complexed with cl, k, peg

Details for d4lp8a2

PDB Entry: 4lp8 (more details), 2.46 Å

PDB Description: A Novel Open-State Crystal Structure of the Prokaryotic Inward Rectifier KirBac3.1
PDB Compounds: (A:) Inward rectifier potassium channel Kirbac3.1

SCOPe Domain Sequences for d4lp8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lp8a2 b.1.18.16 (A:139-295) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrlpifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaq

SCOPe Domain Coordinates for d4lp8a2:

Click to download the PDB-style file with coordinates for d4lp8a2.
(The format of our PDB-style files is described here.)

Timeline for d4lp8a2: