SCOPe 2.06: Domain d4lp8a1: 4lp8 A:13-138

Lineage for d4lp8a1 (4lp8 A:13-138)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (4 PDB entries)

8. Domain d4lp8a1: 4lp8 A:13-138 [229111]
   Other proteins in same PDB: d4lp8a2, d4lp8a3
   automated match to d1xl4a2
   complexed with cl, k, peg

Details for d4lp8a1

PDB Entry: 4lp8, 2.46 Å

PDB Description: A Novel Open-State Crystal Structure of the Prokaryotic Inward Rectifier KirBac3.1

PDB Compounds: (A:) Inward rectifier potassium channel Kirbac3.1

SCOPe Domain Sequences for d4lp8a1:

Sequence, based on SEQRES records:

>d4lp8a1 f.14.1.1 (A:13-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
rilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacg
dvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarliy
arftrp

Sequence, based on observed residues (ATOM records):

>d4lp8a1 f.14.1.1 (A:13-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
rilnsdgssnitrlggwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvie
narpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarliyarft
rp

Timeline for d4lp8a1:

• d4lp8a1 first appeared in SCOPe 2.03
  
• d4lp8a1 appears in SCOPe 2.05
  
• d4lp8a1 appears in SCOPe 2.07
  
• d4lp8a1 appears in the current release, SCOPe 2.08