Lineage for d4lp8a1 (4lp8 A:13-138)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252772Protein automated matches [190184] (3 species)
    not a true protein
  7. 2252775Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (4 PDB entries)
  8. 2252776Domain d4lp8a1: 4lp8 A:13-138 [229111]
    Other proteins in same PDB: d4lp8a2, d4lp8a3
    automated match to d1xl4a2
    complexed with cl, k, peg

Details for d4lp8a1

PDB Entry: 4lp8 (more details), 2.46 Å

PDB Description: A Novel Open-State Crystal Structure of the Prokaryotic Inward Rectifier KirBac3.1
PDB Compounds: (A:) Inward rectifier potassium channel Kirbac3.1

SCOPe Domain Sequences for d4lp8a1:

Sequence, based on SEQRES records: (download)

>d4lp8a1 f.14.1.1 (A:13-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
rilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacg
dvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarliy
arftrp

Sequence, based on observed residues (ATOM records): (download)

>d4lp8a1 f.14.1.1 (A:13-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
rilnsdgssnitrlggwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvie
narpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarliyarft
rp

SCOPe Domain Coordinates for d4lp8a1:

Click to download the PDB-style file with coordinates for d4lp8a1.
(The format of our PDB-style files is described here.)

Timeline for d4lp8a1: