SCOPe 2.05: Domain d4k09b_: 4k09 B:

Lineage for d4k09b_ (4k09 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (25 species)
   not a true protein

7. Species Bothrops brazili [TaxId:157546] [195180] (2 PDB entries)

8. Domain d4k09b_: 4k09 B: [229106]
   automated match to d3i03a_

Details for d4k09b_

PDB Entry: 4k09, 2.11 Å

PDB Description: Crystal structure of BbTX-II from Bothrops brazili venom

PDB Compounds: (B:) BbTX-II

SCOPe Domain Sequences for d4k09b_:

Sequence; same for both SEQRES and ATOM records:

>d4k09b_ a.133.1.2 (B:) automated matches {Bothrops brazili [TaxId: 157546]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdqk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlntynkkyryhlkplckkada
c

Timeline for d4k09b_:

• d4k09b_ first appeared in SCOPe 2.03
  
• d4k09b_ appears in SCOPe 2.04
  
• d4k09b_ appears in SCOPe 2.06
  
• d4k09b_ appears in the current release, SCOPe 2.08