| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Bothrops brazili [TaxId:157546] [195180] (2 PDB entries) |
| Domain d4k09b_: 4k09 B: [229106] automated match to d3i03a_ |
PDB Entry: 4k09 (more details), 2.11 Å
SCOPe Domain Sequences for d4k09b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k09b_ a.133.1.2 (B:) automated matches {Bothrops brazili [TaxId: 157546]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdqk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlntynkkyryhlkplckkada
c
Timeline for d4k09b_: