SCOPe 2.08: Domain d4k09a_: 4k09 A:

Lineage for d4k09a_ (4k09 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Bothrops brazili [TaxId:157546] [195180] (2 PDB entries)

8. Domain d4k09a_: 4k09 A: [229105]
   automated match to d3i03a_

Details for d4k09a_

PDB Entry: 4k09, 2.11 Å

PDB Description: Crystal structure of BbTX-II from Bothrops brazili venom

PDB Compounds: (A:) BbTX-II

SCOPe Domain Sequences for d4k09a_:

Sequence; same for both SEQRES and ATOM records:

>d4k09a_ a.133.1.2 (A:) automated matches {Bothrops brazili [TaxId: 157546]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdqk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlntynkkyryhlkplckkada
c

Timeline for d4k09a_:

• d4k09a_ first appeared in SCOPe 2.03
  
• d4k09a_ appears in SCOPe 2.07