Lineage for d4jraa1 (4jra A:876-1079)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781196Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 1781234Protein automated matches [229097] (3 species)
    not a true protein
  7. 1781235Species Clostridium botulinum [TaxId:1491] [229098] (3 PDB entries)
  8. 1781238Domain d4jraa1: 4jra A:876-1079 [229103]
    Other proteins in same PDB: d4jraa2, d4jrab2
    automated match to d3btaa1
    complexed with cl, na

Details for d4jraa1

PDB Entry: 4jra (more details), 2.3 Å

PDB Description: crystal structure of the botulinum neurotoxin a receptor-binding domain in complex with the luminal domain of sv2c
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d4jraa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jraa1 b.29.1.6 (A:876-1079) automated matches {Clostridium botulinum [TaxId: 1491]}
tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn
smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq
rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf
kldgcrdthryiwikyfnlfdkel

SCOPe Domain Coordinates for d4jraa1:

Click to download the PDB-style file with coordinates for d4jraa1.
(The format of our PDB-style files is described here.)

Timeline for d4jraa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jraa2