![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
![]() | Protein automated matches [229097] (6 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [229098] (12 PDB entries) |
![]() | Domain d4jraa1: 4jra A:876-1079 [229103] Other proteins in same PDB: d4jraa2, d4jrab2 automated match to d3btaa1 complexed with cl, na |
PDB Entry: 4jra (more details), 2.3 Å
SCOPe Domain Sequences for d4jraa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jraa1 b.29.1.6 (A:876-1079) automated matches {Clostridium botulinum [TaxId: 1491]} tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf kldgcrdthryiwikyfnlfdkel
Timeline for d4jraa1: