SCOPe 2.03: Domain d4jrab2: 4jra B:1080-1296

Lineage for d4jrab2 (4jra B:1080-1296)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein automated matches [229100] (3 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [229101] (3 PDB entries)

8. Domain d4jrab2: 4jra B:1080-1296 [229102]
   Other proteins in same PDB: d4jraa1, d4jrab1
   automated match to d3btaa2
   complexed with cl, na

Details for d4jrab2

PDB Entry: 4jra, 2.3 Å

PDB Description: crystal structure of the botulinum neurotoxin a receptor-binding domain in complex with the luminal domain of sv2c

PDB Compounds: (B:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d4jrab2:

Sequence, based on SEQRES records:

>d4jrab2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerpl

Sequence, based on observed residues (ATOM records):

>d4jrab2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasdnivrnndrvyinvvvknkeyrlatnasqagv
ekilsaleipdvgnlsqvvvmkskndqtnkckmnlqdnngndigfigfhqfnniaklvas
nwynrqierlgcswefipvddgwgerpl

Timeline for d4jrab2:

• d4jrab2 is new in SCOPe 2.03-stable
  
• d4jrab2 appears in SCOPe 2.04
  
• d4jrab2 appears in the current release, SCOPe 2.08