Lineage for d1a4bb_ (1a4b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770478Protein Azurin [49530] (6 species)
  7. 2770479Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. 2770489Domain d1a4bb_: 1a4b B: [22910]
    complexed with cu, so4; mutant

Details for d1a4bb_

PDB Entry: 1a4b (more details), 1.91 Å

PDB Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at-180 degrees celsius
PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d1a4bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4bb_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans [TaxId: 32002]}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn

SCOPe Domain Coordinates for d1a4bb_:

Click to download the PDB-style file with coordinates for d1a4bb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4bb_: