SCOPe 2.07: Domain d4jhqb_: 4jhq B:

Lineage for d4jhqb_ (4jhq B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d4jhqb_: 4jhq B: [229093]
   automated match to d4i60a_
   complexed with b6f, nag

Details for d4jhqb_

PDB Entry: 4jhq, 1.99 Å

PDB Description: crystal structure of avidin - 6-(6-biotinamidohexanamido) hexanoylferrocene complex

PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d4jhqb_:

Sequence; same for both SEQRES and ATOM records:

>d4jhqb_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlr

Timeline for d4jhqb_:

• d4jhqb_ first appeared in SCOPe 2.03
  
• d4jhqb_ appears in SCOPe 2.06
  
• d4jhqb_ appears in the current release, SCOPe 2.08