SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4i0ic_ (4i0i C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060235Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2060236Species Human (Homo sapiens) [TaxId:9606] [50672] (278 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2060617Domain d4i0ic_: 4i0i C: [229087]
    automated match to d2hm1a_
    complexed with 957

Details for d4i0ic_

PDB Entry: 4i0i (more details), 2.2 Å

PDB Description: SPR and structural analysis yield insight towards mechanism of inhibition of BACE inhibitors
PDB Compounds: (C:) Beta-secretase 1

SCOPe Domain Sequences for d4i0ic_:

Sequence, based on SEQRES records: (download)

>d4i0ic_ b.50.1.2 (C:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiig
gidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlp
kkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfr
itilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavs
achvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d4i0ic_ b.50.1.2 (C:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnasvggsmiiggidhs
lytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfe
aavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilp
qqylrpvddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaa
vegpfvtldmedcgyn

SCOPe Domain Coordinates for d4i0ic_:

Click to download the PDB-style file with coordinates for d4i0ic_.
(The format of our PDB-style files is described here.)

Timeline for d4i0ic_: