Lineage for d1a4ab_ (1a4a B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380272Protein Azurin [49530] (6 species)
  7. 2380273Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. 2380283Domain d1a4ab_: 1a4a B: [22908]
    complexed with cu; mutant

Details for d1a4ab_

PDB Entry: 1a4a (more details), 1.89 Å

PDB Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius
PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d1a4ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4ab_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans [TaxId: 32002]}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn

SCOPe Domain Coordinates for d1a4ab_:

Click to download the PDB-style file with coordinates for d1a4ab_.
(The format of our PDB-style files is described here.)

Timeline for d1a4ab_: