SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4cesa_ (4ces A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124026Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 protein domains)
  6. 2124148Protein automated matches [190209] (5 species)
    not a true protein
  7. 2124149Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (62 PDB entries)
  8. 2124216Domain d4cesa_: 4ces A: [229075]
    automated match to d4ah9a_
    complexed with cl, nfw, so4

Details for d4cesa_

PDB Entry: 4ces (more details), 1.85 Å

PDB Description: Interrogating HIV integrase for compounds that bind- a SAMPL challenge
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4cesa_:

Sequence, based on SEQRES records: (download)

>d4cesa_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d4cesa_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq

SCOPe Domain Coordinates for d4cesa_:

Click to download the PDB-style file with coordinates for d4cesa_.
(The format of our PDB-style files is described here.)

Timeline for d4cesa_: