SCOP 1.59: Domain d1a4aa_: 1a4a A:

Lineage for d1a4aa_ (1a4a A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)

8. Domain d1a4aa_: 1a4a A: [22907]

Details for d1a4aa_

PDB Entry: 1a4a, 1.89 Å

PDB Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius

SCOP Domain Sequences for d1a4aa_:

Sequence; same for both SEQRES and ATOM records:

>d1a4aa_ b.6.1.1 (A:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn

Timeline for d1a4aa_:

• d1a4aa_ first appeared (with stable ids) in SCOP 1.55
  
• d1a4aa_ appears in SCOP 1.57
  
• d1a4aa_ appears in SCOP 1.61
  
• d1a4aa_ appears in the current release, SCOPe 2.08