Lineage for d4ceab_ (4cea B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2494110Protein automated matches [190209] (5 species)
    not a true protein
  7. 2494111Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries)
  8. 2494165Domain d4ceab_: 4cea B: [229066]
    automated match to d4ah9a_
    complexed with acy, cl, gol, so4, zsw

Details for d4ceab_

PDB Entry: 4cea (more details), 1.8 Å

PDB Description: Interrogating HIV integrase for compounds that bind- a SAMPL challenge
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d4ceab_:

Sequence, based on SEQRES records: (download)

>d4ceab_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records): (download)

>d4ceab_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiqt

SCOPe Domain Coordinates for d4ceab_:

Click to download the PDB-style file with coordinates for d4ceab_.
(The format of our PDB-style files is described here.)

Timeline for d4ceab_: